PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G36640.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 263aa    MW: 29070.9 Da    PI: 9.4319
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G36640.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.93.2e-292373151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+ rqvtf+kRrng+lKKA+EL +LCdae+a+i+fss+g+lye+s+
  OMERI01G36640.2 23 KRIENKTSRQVTFCKRRNGLLKKAYELAILCDAEIALIVFSSRGRLYEFSN 73
                     79***********************************************95 PP

2K-box77.53.5e-2698185996
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       + + +++ qqe+ak++ +i++Lq+ +Rhl+Ge++++++ keL++Le++Lek++++iRskK+  l ++   l+ k  e+++++++ ++
  OMERI01G36640.2  98 IDVNSHQYFQQEAAKMRHQIQTLQNANRHLIGESIGNMTAKELKSLENRLEKGISRIRSKKEADLQNENMFLRAKVAEAERAEHDQQQ 185
                      566889***********************************************************************99998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.3051575IPR002100Transcription factor, MADS-box
SMARTSM004327.4E-411574IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-311689IPR002100Transcription factor, MADS-box
CDDcd002657.68E-441690No hitNo description
PRINTSPR004041.2E-311737IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001771IPR002100Transcription factor, MADS-box
PfamPF003193.1E-262471IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-313752IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-315273IPR002100Transcription factor, MADS-box
PfamPF014863.2E-19100178IPR002487Transcription factor, K-box
PROSITE profilePS5129711.446103191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MVVYMFVKVD RLINMGRGKI EIKRIENKTS RQVTFCKRRN GLLKKAYELA ILCDAEIALI  60
VFSSRGRLYE FSNVNSTRST IERYKKASAS TSGSAPVIDV NSHQYFQQEA AKMRHQIQTL  120
QNANRHLIGE SIGNMTAKEL KSLENRLEKG ISRIRSKKEA DLQNENMFLR AKVAEAERAE  180
HDQQQAAEDD EMAAAAAAGG GSSSGTELEA LPATFDTREY YPPAPPVSML AAAAAAAAQY  240
SSDHHQTALH LGYFKVDSGK GLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-191578164Myocyte-specific enhancer factor 2B
1tqe_Q4e-191578164Myocyte-specific enhancer factor 2B
1tqe_R4e-191578164Myocyte-specific enhancer factor 2B
1tqe_S4e-191578164Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519130.0AY551913.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS207 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015621182.11e-168PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-170MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLA0A0E0CB880.0A0A0E0CB88_9ORYZ; Uncharacterized protein
STRINGORGLA01G0336500.11e-169(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.29e-78MIKC_MADS family protein